Any feedback?
Please rate this page
(search_result.php)
(0/150)

BRENDA support

Refine search

Search Natural Substrates/ Products (Substrates)

show results
Don't show organism specific information (fast!)
Search organism in taxonomic tree (slow, choose "exact" as search mode, e.g. "mammalia" for rat,human,monkey,...)
(Not possible to combine with the first option)
Refine your search
Search for synonyms (with exact matching search term)

Search term:

Results 1 - 10 of 12 > >>
EC Number Natural Substrates Commentary (Nat. Sub.)
Display the word mapDisplay the reaction diagram Show all sequences 3.4.21.118Fibronectin + H2O affects cell adhesion or cell migration by modulating the content and/or chemical characteristics of fibronectin in the extracellular matrix
Display the word mapDisplay the reaction diagram Show all sequences 3.4.21.118LL-37 antimicrobial peptide + H2O i.e. [LL-37, 37 aa]
Display the word mapDisplay the reaction diagram Show all sequences 3.4.21.118more enzyme might be involved in ovarian cancer, brain damage and kindling epilepsy
Display the word mapDisplay the reaction diagram Show all sequences 3.4.21.118more enzyme is involved in the synaptogenesis/maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway
Display the word mapDisplay the reaction diagram Show all sequences 3.4.21.118more enzyme is necessary for establishment of long-term potentiation and has a significant role in memory acquisition
Display the word mapDisplay the reaction diagram Show all sequences 3.4.21.118more enzyme may be impicated in extracellular matrix protein degradation in the area surrounding enzyme producing cells
Display the word mapDisplay the reaction diagram Show all sequences 3.4.21.118polypeptide + H2O -
Display the word mapDisplay the reaction diagram Show all sequences 3.4.21.118polypeptide + H2O enzyme has significant limbic effects by changing the extracellular matrix environment
Display the word mapDisplay the reaction diagram Show all sequences 3.4.21.118polypeptide + H2O involvement in neural plasticity
Display the word mapDisplay the reaction diagram Show all sequences 3.4.21.118polypeptide + H2O enzyme is implicated in various neurological processes including formation of memory
Results 1 - 10 of 12 > >>