Refine search

Search Natural Substrates/ Products (Substrates)

Natural Substrates/ Products (Substrates): show results

Don't show organism specific information (fast!)

Search organism in taxonomic tree (slow, choose "exact" as search mode, e.g. "mammalia" for rat,human,monkey,...)

(Not possible to combine with the first option)

Refine your search

Recommended Name:

EC Number:

Organism:

Commentary (Nat. Sub.):

Natural Products:

Commentary (Nat. Pro.):

Reversibility:

Search for synonyms (with exact matching search term)

Search term:

Results 1 - 6 of 6

EC Number	Natural Substrates	Commentary (Nat. Sub.)
3.4.23.18	chymotrypsinogen A + H2O	activation
3.4.23.18	trypsinogen + H2O	activation by cleavage of a Lys-Pro bond
3.4.23.18	FVNQHLCGSHLVEALYLVCGERGFFYTPKA + 3 H2O	substrate is the oxidized insulin B chain, primarily cleavage at Leu15-Tyr16 and Phe24-Phe25, and minor cleavage of Tyr16-Leu17, overview
3.4.23.18	DRVYIHPFHLLVYS + 3 H2O	tetradecapeptide renin substrate, the enzyme cleaves the Xaa-pro bond with Xaa being any amino acid
3.4.23.18	proangiotensin + H2O	the enzyme cleaves the Xaa-pro bond with Xaa being any amino acid
3.4.23.18	more	the extracellular enzyme pays a role in development of aspergillosis in lung of mammalia, but it is not essential for virulence

Results 1 - 6 of 6

Use of this online version of BRENDA is free under the CC BY 4.0 license. See terms of use for full details.

Release 2023.1 (January 2023)