Refine search

Search Natural Substrates/ Products (Substrates)

show results
Don't show organism specific information (fast!)
Search organism in taxonomic tree (slow, choose "exact" as search mode, e.g. "mammalia" for rat,human,monkey,...)
(Not possible to combine with the first option)
Refine your search
Search for synonyms (with exact matching search term)

Search term:

Results 1 - 6 of 6
EC Number
Natural Substrates
Commentary (Nat. Sub.)
chymotrypsinogen A + H2O
activation
DRVYIHPFHLLVYS + 3 H2O
tetradecapeptide renin substrate, the enzyme cleaves the Xaa-pro bond with Xaa being any amino acid
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + 3 H2O
substrate is the oxidized insulin B chain, primarily cleavage at Leu15-Tyr16 and Phe24-Phe25, and minor cleavage of Tyr16-Leu17, overview
more
the extracellular enzyme pays a role in development of aspergillosis in lung of mammalia, but it is not essential for virulence
proangiotensin + H2O
the enzyme cleaves the Xaa-pro bond with Xaa being any amino acid
trypsinogen + H2O
activation by cleavage of a Lys-Pro bond
Results 1 - 6 of 6