Any feedback?
Please rate this page
(search_result.php)
(0/150)

BRENDA support

Refine search

Search KM Value [mM]

show results
Don't show organism specific information (fast!)
Search organism in taxonomic tree (slow, choose "exact" as search mode, e.g. "mammalia" for rat,human,monkey,...)
(Not possible to combine with the first option)
Refine your search
Image of 2D Structure

Search term:

Results 1 - 10 of 15 > >>
EC Number KM Value [mM] KM Value Maximum [mM] Substrate Commentary Reference
Display the word mapDisplay the reaction diagram Show all sequences 1.14.11.30-999 - more steady-state kinetic analysis and substrate selectivity for hypoxia-inducible factor and 2-oxoglutarate 724225
Display the word mapDisplay the reaction diagram Show all sequences 1.14.11.300.01 - 2-oxoglutarate pH 7.4, 37°C 698722
Display the word mapDisplay the reaction diagram Show all sequences 1.14.11.300.01 - PSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN pH 7.4, 37°C 698722
Display the word mapDisplay the reaction diagram Show all sequences 1.14.11.300.02 - 2-oxoglutarate wild type enzyme, at pH 7.0 and 37°C 743041
Display the word mapDisplay the reaction diagram Show all sequences 1.14.11.300.022 - 2-oxoglutarate pH 7.0, 37°C 725647
Display the word mapDisplay the reaction diagram Show all sequences 1.14.11.300.023 - 2-oxoglutarate mutant enzyme D210G, at pH 7.0 and 37°C 743041
Display the word mapDisplay the reaction diagram Show all sequences 1.14.11.300.025 - 2-oxoglutarate pH 7.8, 37°C, Km-value is determined using soluble extracts of cells expressing enzyme-FLAGHis 659445
Display the word mapDisplay the reaction diagram Show all sequences 1.14.11.300.026 - 2-oxoglutarate mutant enzyme D210E, at pH 7.0 and 37°C 743041
Display the word mapDisplay the reaction diagram Show all sequences 1.14.11.300.07 - DESGLPQLTSYDAEVNAPIQGSRNLLQGEELLRALDQVN mutant enzyme D210E, at pH 7.0 and 37°C 743041
Display the word mapDisplay the reaction diagram Show all sequences 1.14.11.300.07 - O2 mutant enzyme D210E, at pH 7.0 and 37°C 743041
Results 1 - 10 of 15 > >>