Any feedback?
Please rate this page
(search_result.php)
(0/150)

BRENDA support

Refine search

Search KM Value [mM]

show results
Don't show organism specific information (fast!)
Search organism in taxonomic tree (slow, choose "exact" as search mode, e.g. "mammalia" for rat,human,monkey,...)
(Not possible to combine with the first option)
Refine your search
Image of 2D Structure

Search term:

Results 1 - 9 of 9
EC Number KM Value [mM] KM Value Maximum [mM] Substrate Commentary Reference
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.820.48 - QTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLK biotinylated peptide containing aggrecanase cleavage site 638966
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.820.0471 - [C6-(Gly-Pro-Hyp)5-Gly-Thr-Lys(7-amido-4-methylcoumarin)-Gly-Glu-Leu-Glu-Gly-Arg-Gly-Thr-Lys(2,4-dinitrophenyl)-Gly-Ile-Ser-(Gly-Pro-Hyp)5-NH2]3 ADAMTS-4-2, at 25°C 680769
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.820.279 - C6-(Gly-Pro-Hyp-Pro-Hyp-Gly)2-Gly-Pro-Hyp-Gly-Thr-Lys(Mca)-Gly-Glu-Leu-Glu-Gly-Arg-Gly-Thr-Lys(Dnp)-Gly-Ile-Ser-(Gly-Pro-Hyp-Pro-Hyp-Gly)2-Gly-Pro-Hyp-NH2 ADAMTS-4-2, at 25°C 680769
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.820.65 - [C6-(Gly-Pro-Hyp)5-Gly-Thr-Lys(7-amido-4-methylcoumarin)-Gly-Glu-Leu-Glu-Gly-Arg-Gly-Thr-Lys(2,4-dinitrophenyl)-Gly-Ile-Ser-(Gly-Pro-Hyp)5-NH2]3 ADAMTS-4-2, at 25°C 680769
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.820.761 - C6-(Gly-Pro-Hyp-Pro-Hyp-Gly)2-Gly-Pro-Hyp-Gly-Thr-Lys(Mca)-Gly-Glu-Leu-Glu-Gly-Arg-Gly-Thr-Lys(Dnp)-Gly-Ile-Ser-(Gly-Pro-Hyp-Pro-Hyp-Gly)2-Gly-Pro-Hyp-NH2 ADAMTS-4-2, at 25°C 680769
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.820.0203 - Aggrecan in 100 mM NaCl 680792
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.820.0282 - chondroitin 4-sulfate in 100 mM NaCl 680792
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.820.035 - Lys(carboxyfluorescein)-Asp-Val-Gln-Glu-Phe-Arg-Gly-Val-Thr-Ala-Val-Ile-Arg-Lys(tetramethylrhodamine)-Lys-Gly-Lys-NH2 pH 7.5, 37°C 708082
Display the word mapDisplay the reaction diagram Show all sequences 3.4.24.820.015 - 5-carboxyfluorescein-Ala-Glu-Leu-Gln-Gly-Arg-Pro-Ile-Ser-Ile-Ala-Lys-N,N,N',N'-tetramethyl-6-carboxyrhodamine at pH 7.5 and 37°C 754633
Results 1 - 9 of 9