Refine search

Search KM Value [mM]

show results
Don't show organism specific information (fast!)
Search organism in taxonomic tree (slow, choose "exact" as search mode, e.g. "mammalia" for rat,human,monkey,...)
(Not possible to combine with the first option)
Refine your search
Image of 2D Structure

Search term:

Results 1 - 8 of 8
EC Number
KM Value [mM]
KM Value Maximum [mM]
Substrate
Commentary
Reference
0.0203
-
Aggrecan
in 100 mM NaCl
0.0282
-
chondroitin 4-sulfate
in 100 mM NaCl
0.035
-
Lys(carboxyfluorescein)-Asp-Val-Gln-Glu-Phe-Arg-Gly-Val-Thr-Ala-Val-Ile-Arg-Lys(tetramethylrhodamine)-Lys-Gly-Lys-NH2
pH 7.5, 37°C
0.0471
-
[C6-(Gly-Pro-Hyp)5-Gly-Thr-Lys(7-amido-4-methylcoumarin)-Gly-Glu-Leu-Glu-Gly-Arg-Gly-Thr-Lys(2,4-dinitrophenyl)-Gly-Ile-Ser-(Gly-Pro-Hyp)5-NH2]3
ADAMTS-4-2, at 25°C
0.279
-
C6-(Gly-Pro-Hyp-Pro-Hyp-Gly)2-Gly-Pro-Hyp-Gly-Thr-Lys(Mca)-Gly-Glu-Leu-Glu-Gly-Arg-Gly-Thr-Lys(Dnp)-Gly-Ile-Ser-(Gly-Pro-Hyp-Pro-Hyp-Gly)2-Gly-Pro-Hyp-NH2
ADAMTS-4-2, at 25°C
0.48
-
QTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLK
biotinylated peptide containing aggrecanase cleavage site
0.65
-
[C6-(Gly-Pro-Hyp)5-Gly-Thr-Lys(7-amido-4-methylcoumarin)-Gly-Glu-Leu-Glu-Gly-Arg-Gly-Thr-Lys(2,4-dinitrophenyl)-Gly-Ile-Ser-(Gly-Pro-Hyp)5-NH2]3
ADAMTS-4-2, at 25°C
0.761
-
C6-(Gly-Pro-Hyp-Pro-Hyp-Gly)2-Gly-Pro-Hyp-Gly-Thr-Lys(Mca)-Gly-Glu-Leu-Glu-Gly-Arg-Gly-Thr-Lys(Dnp)-Gly-Ile-Ser-(Gly-Pro-Hyp-Pro-Hyp-Gly)2-Gly-Pro-Hyp-NH2
ADAMTS-4-2, at 25°C
Results 1 - 8 of 8