Cloned (Comment) | Organism |
---|---|
penicillopepsin-JT1, DNA and amino acid sequence determination and analysis | Penicillium janthinellum |
penicillopepsin-JT2, DNA and amino acid sequence determination and analysis | Penicillium janthinellum |
penicillopepsin-JT3, DNA and amino acid sequence determination and analysis | Penicillium janthinellum |
Crystallization (Comment) | Organism |
---|---|
purified penicillopepsin-JT1, free or bound to difluorostatine- and difluorostatone-containing peptides, X-ray diffraction structure determination and analysis at 0.95-2.8 A resolution | Penicillium janthinellum |
Protein Variants | Comment | Organism |
---|---|---|
T219A | site-directed mutagenesis, comparison of substrate binding to the wild-type enzyme | Penicillium janthinellum |
T219G | site-directed mutagenesis, comparison of substrate binding to the wild-type enzyme | Penicillium janthinellum |
T219S | site-directed mutagenesis, comparison of substrate binding to the wild-type enzyme | Penicillium janthinellum |
T219V | site-directed mutagenesis, comparison of substrate binding to the wild-type enzyme | Penicillium janthinellum |
Inhibitors | Comment | Organism | Structure |
---|---|---|---|
Diazoacetyl-DL-norleucine methyl ester | i.e. DAN, active-site directed inhibitor | Penicillium camemberti | |
Diazoacetyl-DL-norleucine methyl ester | i.e. DAN, active-site directed inhibitor, inactivation, also by related compounds | Penicillium duponti | |
Diazoacetyl-DL-norleucine methyl ester | i.e. DAN, active-site directed inhibitor | Penicillium janthinellum | |
isovaleryl-Val-statine-ethoxy | pepstatin analogue | Penicillium janthinellum |
KM Value [mM] | KM Value Maximum [mM] | Substrate | Comment | Organism | Structure |
---|---|---|---|---|---|
additional information | - |
additional information | substrate binding subsite kinetics | Penicillium janthinellum |
Molecular Weight [Da] | Molecular Weight Maximum [Da] | Comment | Organism |
---|---|---|---|
33400 | - |
x * 33400 | Penicillium roqueforti |
33422 | - |
x * 33422, amino acid sequence calculation | Penicillium janthinellum |
33500 | - |
x * 33500 | Penicillium camemberti |
33800 | - |
x * 33800 | Penicillium janthinellum |
41590 | - |
x * 41590 | Penicillium duponti |
Organism | UniProt | Comment | Textmining |
---|---|---|---|
Penicillium camemberti | - |
- |
- |
Penicillium duponti | - |
thermophilic fungus | - |
Penicillium duponti K1014 | - |
thermophilic fungus | - |
Penicillium janthinellum | - |
isozymes penicillopepsin-JT1 and penicillopepsin-JT3 | - |
Penicillium janthinellum | P78735 | precursor; penicillopepsin-JT2 | - |
Penicillium janthinellum | Q9HEZ3 | precursor; penicillopepsin-JT3 | - |
Penicillium roqueforti | - |
- |
- |
Posttranslational Modification | Comment | Organism |
---|---|---|
glycoprotein | - |
Penicillium janthinellum |
glycoprotein | highly glycosylated enzyme | Penicillium duponti |
proteolytic modification | autoprocessing of the zymogen | Penicillium janthinellum |
proteolytic modification | autoprocessing of the zymogen releasing the propeptide Val(Asn)4-Lys | Penicillium janthinellum |
proteolytic modification | autoprocessing of the zymogen releasing the propeptide Val(Asn)4-Lys-OH | Penicillium janthinellum |
Purification (Comment) | Organism |
---|---|
- |
Penicillium duponti |
- |
Penicillium roqueforti |
- |
Penicillium camemberti |
penicillopepsin-JT1 to homogeneity | Penicillium janthinellum |
penicillopepsin-JT2 | Penicillium janthinellum |
Substrates | Comment Substrates | Organism | Products | Comment (Products) | Rev. | Reac. |
---|---|---|---|---|---|---|
Ac-(Ala)n-Lys-Nph-(Ala)m-amide + H2O | - |
Penicillium janthinellum | Ac-(Ala)n-Lys + Nph-(Ala)m-amide | - |
? | |
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O | i.e. insulin B chain, cleavage site specificity | Penicillium janthinellum | FVNQHLCGSHLVEALYLVCG + ERGFFYTPKA | - |
? | |
additional information | broad protein substrate specificity | Penicillium duponti | ? | - |
? | |
additional information | broad protein substrate specificity | Penicillium roqueforti | ? | - |
? | |
additional information | broad protein substrate specificity | Penicillium camemberti | ? | - |
? | |
additional information | broad protein substrate specificity with preference for hydrophobic residues at positions P1 and P1', especially for Lys in P1 because the epsilon-amino group forms an ionic bond with the side-chain carboxylate of Asp77, substrate specificity involves the side chain of the P3 residue, mechanism, detailed overview | Penicillium janthinellum | ? | - |
? | |
additional information | substrate binding specificity, cleavage site specificity, overview | Penicillium janthinellum | ? | - |
? | |
additional information | broad protein substrate specificity | Penicillium duponti K1014 | ? | - |
? | |
trypsin inhibitor + H2O | substrate from Cucurbita maxima, specific cleavage of Leu7-Met8 bond at pH 3.3 | Penicillium camemberti | trypsin inhibitor fragments | - |
? | |
trypsinogen + H2O | substrate from Bos taurus, rapid activation | Penicillium janthinellum | trypsin + propeptide Val(Asn)4-Lys-OH | - |
? | |
trypsinogen + H2O | rapid activation | Penicillium duponti | trypsin + Val(Asn)4-Lys | - |
? | |
trypsinogen + H2O | rapid activation | Penicillium roqueforti | trypsin + Val(Asn)4-Lys | - |
? | |
trypsinogen + H2O | rapid activation | Penicillium camemberti | trypsin + Val(Asn)4-Lys | - |
? | |
trypsinogen + H2O | rapid activation | Penicillium duponti K1014 | trypsin + Val(Asn)4-Lys | - |
? |
Subunits | Comment | Organism |
---|---|---|
? | x * 33400 | Penicillium roqueforti |
? | x * 33422, amino acid sequence calculation | Penicillium janthinellum |
? | x * 33500 | Penicillium camemberti |
? | x * 33800 | Penicillium janthinellum |
? | x * 41590 | Penicillium duponti |
More | three-dimensional structure and comparison | Penicillium janthinellum |
Synonyms | Comment | Organism |
---|---|---|
mold kinase | - |
Penicillium janthinellum |
More | the enzyme belongs to the A1 peptidase family | Penicillium janthinellum |
penicillium kinase | - |
Penicillium janthinellum |
penicillopepsin-JT1 | - |
Penicillium janthinellum |
penicillopepsin-JT2 | - |
Penicillium janthinellum |
penicillopepsin-JT3 | - |
Penicillium janthinellum |
Peptidase A | - |
Penicillium janthinellum |
Turnover Number Minimum [1/s] | Turnover Number Maximum [1/s] | Substrate | Comment | Organism | Structure |
---|---|---|---|---|---|
420 | - |
Trypsinogen | - |
Penicillium janthinellum |
Organism | Comment | pI Value Maximum | pI Value |
---|---|---|---|
Penicillium janthinellum | below, penicillopepsin-JT1 | - |
3 |
Penicillium duponti | - |
- |
3.3 |