Any feedback?
Please rate this page
(literature.php)
(0/150)

BRENDA support

Literature summary for 3.4.18.1 extracted from

  • Obermajer, N.; Doljak, B.; Jamnik, P.; Fonovic, U.P.; Kos, J.
    Cathepsin X cleaves the C-terminal dipeptide of alpha- and gamma-enolase and impairs survival and neuritogenesis of neuronal cells (2009), Int. J. Biochem. Cell Biol., 41, 1685-1696.
    View publication on PubMed
Search for more literature for 3.4.18.1

Cloned(Commentary)

Cloned (Comment) Organism
expression of procathepsin X in Pichia pastoris as an alpha-factor fusion Homo sapiens

Natural Substrates/ Products (Substrates)

Natural Substrates Organism Comment (Nat. Sub.) Natural Products Comment (Nat. Pro.) Rev. Reac.
alpha-enolase + H2O Homo sapiens cathepsin X cleaves the C-terminal dipeptide of alpha- and gamma-enolase abolishing their neurotrophic activity ?
-
 ?
gamma-enolase + H2O Homo sapiens cathepsin X cleaves the C-terminal dipeptide of alpha- and gamma-enolase abolishing their neurotrophic activity ?
-
 ?
additional information Homo sapiens co-localization of alpha or gamma enolase and cathepsin X. Cathepsin X impairs survival and neuritogenesis of neuronal cells, e.g. it reduces PC12 cell survival and neuritogenesis ?
-
 ?

Organism

Organism UniProt Comment Textmining
Homo sapiens
-
-
-

Posttranslational Modification

Posttranslational Modification Comment Organism
proteolytic modification procathepsin X has to be activated Homo sapiens

Source Tissue

Source Tissue Comment Organism Textmining
KG-1 cell a human myeloblast cell line, derived from bone marrow aspirate obtained from male with erythroleukemia that evolved into acute myelogenous leukemia. KG-1 cells differentiate to macrophage like cells, express significant amount of cathepsin X Homo sapiens
-
neuron
-
 Homo sapiens
-

Substrates and Products (Substrate)

Substrates Comment Substrates Organism Products Comment (Products) Rev. Reac.
AKYNQLMRIEEELGEEARFAGHNFRNPSVL + H2O a model peptide derived from rat gamma-enolase carboxyl terminal, overview Homo sapiens ?
-
 ?
alpha-enolase + H2O cathepsin X cleaves the C-terminal dipeptide of alpha- and gamma-enolase abolishing their neurotrophic activity Homo sapiens ?
-
 ?
alpha-enolase + H2O cathepsin X cleaves the C-terminal dipeptide Homo sapiens ?
-
 ?
gamma-enolase + H2O cathepsin X cleaves the C-terminal dipeptide of alpha- and gamma-enolase abolishing their neurotrophic activity Homo sapiens ?
-
 ?
gamma-enolase + H2O cathepsin X cleaves the C-terminal dipeptide Homo sapiens ?
-
 ?
KAKFAGRNPRNPLAK + H2O a model peptide derived from human alpha-enolase carboxyl terminal, overview Homo sapiens ?
-
 ?
additional information co-localization of alpha or gamma enolase and cathepsin X. Cathepsin X impairs survival and neuritogenesis of neuronal cells, e.g. it reduces PC12 cell survival and neuritogenesis Homo sapiens ?
-
 ?

pH Optimum

pH Optimum Minimum pH Optimum Maximum Comment Organism
5.5
-
 assay at Homo sapiens