Any feedback?
Literature summary for 2.7.11.26 extracted from
- Mechanisms of regulation and diverse activities of tau-tubulin kinase (TTBK) isoforms (2021), Cell. Mol. Neurobiol., 41, 669-685 .
Cloned(Commentary)
| Cloned (Comment) | Organism |
|---|---|
| isoform TTBK1 is expressed in HEK-293T cells | Mus musculus |
| isoform TTBK2 kinase domain is expressed in Escherichia coli strain NEB2523 | Homo sapiens |
Crystallization (Commentary)
| Crystallization (Comment) | Organism |
|---|---|
| isoform TTBK2 kinase domain with ADP, using 0.1 M Tris pH 8.5, 10% (v/v) glycerol and 2 M Na/K phosphate | Mus musculus |
| isoform TTBK2 kinase domain with ADP, using 0.1 M Tris pH 8.5, 10% (v/v) glycerol and 2 M Na/K phosphate | Homo sapiens |
Protein Variants
| Protein Variants | Comment | Organism |
|---|---|---|
| K50A | kinase-dead mutant | Homo sapiens |
| K63A | kinase-dead mutant | Homo sapiens |
Inhibitors
| Inhibitors | Comment | Organism | Structure |
|---|---|---|---|
| 4-(2-amino-5,6,7,8-tetrahydropyrimido[4',5':3,4]cyclohept[1,2-b]indol-11-yl)-2-methyl-3-butyn-2-ol | - |
Homo sapiens | |
| BIIB-TTBKi-284 | - |
Mus musculus |
Metals/Ions
| Metals/Ions | Comment | Organism | Structure |
|---|---|---|---|
| Mg2+ | required | Mus musculus |  |
| Mg2+ | required | Homo sapiens | |
Natural Substrates/ Products (Substrates)
| Natural Substrates | Organism | Comment (Nat. Sub.) | Natural Products | Comment (Nat. Pro.) | Rev. | Reac. |
|---|---|---|---|---|---|---|
| ATP + tau-protein | Mus musculus | - |
ADP + O-phospho-tau-protein | - |
? | |
| ATP + tau-protein | Homo sapiens | - |
ADP + O-phospho-tau-protein | - |
? | |
| ATP + tau-protein | Homo sapiens | isoform TTBK1 is the isoform responsible for tau phosphorylation at epitopes enriched in tauopathies such as serine 422 | ADP + O-phospho-tau-protein | - |
? | |
| ATP + tau-protein | Mus musculus | isoform TTBK1 is the isoform responsible for tau phosphorylation at epitopes enriched in tauopathies such as serine 422 | ADP + O-phospho-tau-protein | - |
? | |
Organism
| Organism | UniProt | Comment | Textmining |
|---|---|---|---|
| Homo sapiens | Q5TCY1 | - |
- |
| Homo sapiens | Q6IQ55 | - |
- |
| Mus musculus | Q3UVR3 | - |
- |
| Mus musculus | Q6PCN3 | - |
- |
Purification (Commentary)
| Purification (Comment) | Organism |
|---|---|
| nickel resin column chromatography and Superdex 75 gel filtration | Mus musculus |
| nickel resin column chromatography and Superdex 75 gel filtration | Homo sapiens |
Source Tissue
| Source Tissue | Comment | Organism | Textmining |
|---|---|---|---|
| brain | - |
Homo sapiens | - |
| cartilage | - |
Mus musculus | - |
| cerebellum | - |
Mus musculus | - |
| cerebellum | high expression | Mus musculus | - |
| cerebral cortex | - |
Mus musculus | - |
| cerebral cortex | high expression | Mus musculus | - |
| cerebral cortical neuron | highest expression | Mus musculus | - |
| additional information | not detected in blood, sciatic nerve, small intestine, skin, pancreas, muscle, and cartilage | Mus musculus | - |
| additional information | not detected in blood, small intestine, spleen, skin, and pancreas | Mus musculus | - |
| muscle | weakest expression | Mus musculus | - |
| sciatic nerve | - |
Mus musculus | - |
| spinal cord | high expression | Mus musculus | - |
| spinal ganglion | - |
Mus musculus | - |
| spleen | weakest expression | Mus musculus | - |
Substrates and Products (Substrate)
| Substrates | Comment Substrates | Organism | Products | Comment (Products) | Rev. | Reac. |
|---|---|---|---|---|---|---|
| ATP + HLSNVSSTGSIDMVDSPQLATLADEVSASLAK | - |
Mus musculus | ADP + HLSNVSSTGSIDMVDpSPQLATLADEVSASLAK | - |
? | |
| ATP + HLSNVSSTGSIDMVDSPQLATLADEVSASLAK | - |
Homo sapiens | ADP + HLSNVSSTGSIDMVDpSPQLATLADEVSASLAK | - |
? | |
| ATP + tau-protein | - |
Mus musculus | ADP + O-phospho-tau-protein | - |
? | |
| ATP + tau-protein | - |
Homo sapiens | ADP + O-phospho-tau-protein | - |
? | |
| ATP + tau-protein | isoform TTBK1 is the isoform responsible for tau phosphorylation at epitopes enriched in tauopathies such as serine 422 | Homo sapiens | ADP + O-phospho-tau-protein | - |
? | |
| ATP + tau-protein | isoform TTBK1 is the isoform responsible for tau phosphorylation at epitopes enriched in tauopathies such as serine 422 | Mus musculus | ADP + O-phospho-tau-protein | - |
? | |
| additional information | isoform TTBK1 is autophosphorylated | Homo sapiens | ? | - |
- |
|
| additional information | isoform TTBK1 is autophosphorylated | Mus musculus | ? | - |
- |
|
| additional information | isoform TTBK2 is autophosphorylated | Mus musculus | ? | - |
- |
|
| additional information | isoform TTBK2 is autophosphorylated | Homo sapiens | ? | - |
- |
|
Synonyms
| Synonyms | Comment | Organism |
|---|---|---|
| tau-tubulin kinase | - |
Mus musculus |
| tau-tubulin kinase | - |
Homo sapiens |
| TTBK1 | isoform | Homo sapiens |
| TTBK1 | isoform | Mus musculus |
| TTBK2 | isoform | Mus musculus |
| TTBK2 | isoform | Homo sapiens |
IC50 Value
| IC50 Value | IC50 Value Maximum | Comment | Organism | Inhibitor | Structure |
|---|---|---|---|---|---|
| 0.0000095 | - |
isoform TTBK1, pH and temperature not specified in the publication | Mus musculus | BIIB-TTBKi-284 | |
| 0.000738 | - |
isoform TTBK1, pH and temperature not specified in the publication | Homo sapiens | 4-(2-amino-5,6,7,8-tetrahydropyrimido[4',5':3,4]cyclohept[1,2-b]indol-11-yl)-2-methyl-3-butyn-2-ol | |
| 0.000801 | - |
isoform TTBK1, pH and temperature not specified in the publication | Homo sapiens | 4-(2-amino-5,6,7,8-tetrahydropyrimido[4',5':3,4]cyclohept[1,2-b]indol-11-yl)-2-methyl-3-butyn-2-ol |
Use of this online version of BRENDA is free under the CC BY 4.0 license. See terms of use for full details.
Release 2023.1 (January 2023)
Legal
Curated at
Member of
