Any feedback?
Please rate this page
(literature.php)
(0/150)

BRENDA support

Literature summary for 2.4.99.18 extracted from

  • Gayen, S.; Kang, C.
    Solution structure of a human minimembrane protein Ost4, a subunit of the oligosaccharyltransferase complex (2011), Biochem. Biophys. Res. Commun., 409, 572-576.
    View publication on PubMed
Search for more literature for 2.4.99.18

Localization

Localization Comment Organism GeneOntology No. Textmining
membrane associated Homo sapiens 16020
-

Natural Substrates/ Products (Substrates)

Natural Substrates Organism Comment (Nat. Sub.) Natural Products Comment (Nat. Pro.) Rev. Reac.
dolichyl diphosphooligosaccharide + [protein]-L-asparagine Homo sapiens
-
 dolichyl diphosphate + [protein]-L-asparagine-N-oligosaccharide a glycoprotein with the oligosaccharide chain attached by N-beta-D-glycosyl linkage to a protein L-asparagine ?

Organism

Organism UniProt Comment Textmining
Homo sapiens
-
-
-

Source Tissue

Source Tissue Comment Organism Textmining
commercial preparation about 95% purity Homo sapiens
-

Substrates and Products (Substrate)

Substrates Comment Substrates Organism Products Comment (Products) Rev. Reac.
dolichyl diphosphooligosaccharide + [protein]-L-asparagine
-
 Homo sapiens dolichyl diphosphate + [protein]-L-asparagine-N-oligosaccharide a glycoprotein with the oligosaccharide chain attached by N-beta-D-glycosyl linkage to a protein L-asparagine ?

Subunits

Subunits Comment Organism
heptamer the human Ost4 protein contains 37 amino acids, i.e. MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE, Ost4 is a small membrane protein and belongs to one of the seven subunits of human OST, structure analysis by NMR spectroscopy, residues 5-30 adopt an alpha-helical structure, and a kink structure in the transmembrane domain may be important for its function, overview Homo sapiens

Synonyms

Synonyms Comment Organism
oligosaccharyltransferase
-
 Homo sapiens
OST
-
 Homo sapiens