Ligand A

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.

Basic Ligand Information

Molecular Structure
Picture of A (click for magnification)
Molecular Formula
BRENDA Name
InChIKey
HR
A
PGLQOBBPBPTBQS-UHFFFAOYSA-N
Synonyms:
halide, HX, oxidized donor, oxidized putidaredoxin, R1H, RH

Show all pahtways known for Show all pathways known for A

Roles as Enzyme Ligand

In Vivo Substrate in Enzyme-catalyzed Reactions (2 results)

EC NUMBER
PROVEN IN VIVO REACTION
REACTION DIAGRAM
LITERATURE
ENZYME 3D STRUCTURE
RH + chloride + H2O2 = RCl + H2O
show the reaction diagram
-
RH + [reduced NADPH-hemoprotein reductase] + O2 = ROH + [oxidized NADPH-hemoprotein reductase] + H2O
show the reaction diagram
-

In Vivo Product in Enzyme-catalyzed Reactions (99 results)

EC NUMBER
PROVEN IN VIVO REACTION
REACTION DIAGRAM
LITERATURE
ENZYME 3D STRUCTURE
fumitremorgin B + 2-oxoglutarate + 2 O2 + AH2 = verruculogen + succinate + CO2 + H2O + A
show the reaction diagram
-
-
L-tyrosine + O2 + AH2 = L-3,4-dihydroxyphenylalanine + H2O + A
show the reaction diagram
-
-
androst-4-ene-3,17-dione + AH2 + O2 = 3-oxo-13,17-secoandrost-4-ene-17,13alpha-lactone + A + H2O
show the reaction diagram
-
-
4-methoxybenzoate + AH2 + O2 = 4-hydroxybenzoate + formaldehyde + A + H2O
show the reaction diagram
-
-
O-1-alkyl-2-acyl-sn-glycero-3-phosphoethanolamine + AH2 + O2 = O-1-alk-1-enyl-2-acyl-sn-glycero-3-phosphoethanolamine + A + 2 H2O
show the reaction diagram
-
-
Latia luciferin + AH2 + O2 = oxidized Latia luciferin + CO2 + formate + A + H2O + hnu
show the reaction diagram
-
-
ecdysone + AH2 + O2 = 20-hydroxyecdysone + A + H2O
show the reaction diagram
-
-
progesterone + AH2 + O2 = 9alpha-hydroxyprogesterone + A + H2O
show the reaction diagram
-
-
thiophene-2-carbonyl-CoA + AH2 + O2 = 5-hydroxythiophene-2-carbonyl-CoA + A + H2O
show the reaction diagram
-
-
cholesterol + AH2 + O2 = 25-hydroxycholesterol + A + H2O
show the reaction diagram
-
-
ammonia + AH2 + O2 = NH2OH + A + H2O
show the reaction diagram
-
-
[(1->4)-beta-D-glucosyl]n+m + AH2 + O2 = [(1->4)-beta-D-glucosyl]m-1-(1->4)-D-glucono-1,5-lactone + [(1->4)-beta-D-glucosyl]n + A + H2O
show the reaction diagram
-
-
starch + AH2 + O2 = aldonic acid-terminated malto-oligosaccharides + A + H2O
show the reaction diagram
-
-
heme + 3 AH2 + 3 O2 = biliverdin + Fe2+ + CO + 3 A + 3 H2O
show the reaction diagram
-
-
2,3-epoxyphylloquinone + AH2 = phylloquinone + A + ?
show the reaction diagram
-
-
reduced putidaredoxin + NAD+ = oxidized putidaredoxin + NADH + H+
show the reaction diagram
-
-
chlorophyllide a + AH2 + ATP + H2O = 3-deacetyl-3-vinylbacteriochlorophyllide a + A + ADP + phosphate
show the reaction diagram
-
-
AH2 + chlorate = A + H2O + chlorite
show the reaction diagram
-
-
haloacetate + H2O = glycolate + halide
show the reaction diagram
-
-
(R)-2-haloacid + H2O = (S)-2-hydroxyacid + halide
show the reaction diagram
-
-

Substrate in Enzyme-catalyzed Reactions (9 results)

EC NUMBER
REACTION
REACTION DIAGRAM
LITERATURE
ENZYME 3D STRUCTURE
RH + chloride + H2O2 = RCl + H2O
show the reaction diagram
-
RH + I- + H2O2 + H+ = RI + H2O
show the reaction diagram
-
RH + [reduced NADPH-hemoprotein reductase] + O2 = ROH + [oxidized NADPH-hemoprotein reductase] + H2O
show the reaction diagram
-
3,3',5'-triido-L-thyronine + iodide + A + H+ = L-thyroxine + AH2
show the reaction diagram
-
3,5,3'-triiodo-L-thyronine + iodide + A + H+ = L-thyroxine + AH2
show the reaction diagram
-
succinate + oxidized donor = ?
show the reaction diagram
-

Product in Enzyme-catalyzed Reactions (279 results)

EC NUMBER
REACTION
REACTION DIAGRAM
LITERATURE
ENZYME 3D STRUCTURE
fumitremorgin B + 2-oxoglutarate + 2 O2 + AH2 = verruculogen + succinate + CO2 + H2O + A
show the reaction diagram
-
-
styrene + O2 + reduced putidaredoxin = (S)-styrene oxide + 2-phenylethanol + oxidized putidaredoxin + H2O
show the reaction diagram
-
-
(+)-camphor + reduced putidaredoxin + O2 = (+)-6-endo-hydroxycamphor + oxidized putidaredoxin + H2O
show the reaction diagram
-
-
palmitoyl-[acyl-carrier protein] + AH2 + O2 = palmitoleoyl-[acyl-carrier protein] + A + H2O
show the reaction diagram
-
-
tetradecanoic acid + O2 + AH2 = (11E)-tetradec-11-enoic acid + A + H2O
show the reaction diagram
-
-
O-1-alkyl-2-acyl-sn-glycero-3-phosphoethanolamine + AH2 + O2 = O-1-alk-1-enyl-2-acyl-sn-glycero-3-phosphoethanolamine + A + 2 H2O
show the reaction diagram
-
-
Latia luciferin + AH2 + O2 = oxidized Latia luciferin + CO2 + formate + A + H2O + hnu
show the reaction diagram
-
-
ecdysone + AH2 + O2 = 20-hydroxyecdysone + A + H2O
show the reaction diagram
-
-
progesterone + AH2 + O2 = 9alpha-hydroxyprogesterone + A + H2O
show the reaction diagram
-
-
thiophene-2-carbonyl-CoA + AH2 + O2 = 5-hydroxythiophene-2-carbonyl-CoA + A + H2O
show the reaction diagram
-
-
cholesterol + AH2 + O2 = 25-hydroxycholesterol + A + H2O
show the reaction diagram
-
-
ammonia + AH2 + O2 = NH2OH + A + H2O
show the reaction diagram
-
-
(+)-larreatricin + O2 + AH2 = (+)-3-hydroxylarreatricin + A + H2O
show the reaction diagram
-
-
starch + AH2 + O2 = aldonic acid-terminated malto-oligosaccharides + A + H2O
show the reaction diagram
-
-
heme + 3 AH2 + 3 O2 = biliverdin + Fe2+ + CO + 3 A + 3 H2O
show the reaction diagram
-
-
2,3-epoxyphylloquinone + AH2 = phylloquinone + A + ?
show the reaction diagram
-
-
fumarate + electron donor = succinate + oxidized donor
show the reaction diagram
-
-
chlorophyllide a + AH2 + ATP + H2O = 3-deacetyl-3-vinylbacteriochlorophyllide a + A + ADP + phosphate
show the reaction diagram
-
-
AH2 + chlorate = A + H2O + chlorite
show the reaction diagram
-
-
selenate + electron donor = selenite + H2O + oxidized donor
show the reaction diagram
-
-
CO + methyl-X + HS-CoA = CH3-CO-S-CoA + HX
show the reaction diagram
-
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O = FVNQHLCGSHLVE + A + LYLVCGERGF + FY + TPKA
show the reaction diagram
-
-
haloacetate + H2O = glycolate + halide
show the reaction diagram
-
-
(R)-2-haloacid + H2O = (S)-2-hydroxyacid + halide
show the reaction diagram
-
-
RHg+ + H+ = RH + Hg2+
show the reaction diagram
-

Inhibitor in Enzyme-catalyzed Reactions (2 results)

EC NUMBER
COMMENTARY
LITERATURE
ENZYME 3D STRUCTURE

Enzyme Kinetic Parameters

References & Links

Links to other databases for A

ChEBI
PubChem
ChEBI
PubChem