Ligand L-phenylalanine

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.

Basic Ligand Information

Molecular Structure
Picture of L-phenylalanine (click for magnification)
Molecular Formula
(2S)-2-amino-3-phenylpropanoic acid, L-Phe, L-phenylanine, Phe, Phe-OH, phenylalanine
Pathway Source

Show all pahtways known for Show all BRENDA pathways known for L-phenylalanine

Roles as Enzyme Ligand

In Vivo Substrate in Enzyme-catalyzed Reactions (41 results)

L-phenylalanine + O2 = ? + H2O2
show the reaction diagram
L-phenylalanine + tetrahydrobiopterin + O2 = 3-hydroxy-L-phenylalanine + 4a-hydroxytetrahydrobiopterin
show the reaction diagram
acetyl-CoA + L-phenylalanine = CoA + N-acetyl-L-phenylalanine
show the reaction diagram
L-phenylalanine + pyruvate = phenylpyruvate + L-alanine
show the reaction diagram
L-phenylalanine + O2 + H2O = phenylacetaldehyde + CO2 + NH3 + H2O2
show the reaction diagram
L-phenylalanine = (E)-cinnamate + NH3
show the reaction diagram
L-phenylalanine = L-beta-phenylalanine
show the reaction diagram
L-phenylalanine = D-beta-phenylalanine
show the reaction diagram
ATP + H2O + phenylalanine/out = ADP + phosphate + phenylalanine/in
show the reaction diagram

In Vivo Product in Enzyme-catalyzed Reactions (17 results)

phenylpyruvate + NH3 + NADH = L-phenylalanine + H2O + NAD+
show the reaction diagram
L-tryptophan + phenylpyruvate = 3-indole-2-oxopropanoate + L-phenylalanine
show the reaction diagram
L-glutamine + phenylpyruvate = 2-oxoglutaramate + L-phenylalanine
show the reaction diagram
L-aspartate + 3-phenylpyruvate = oxaloacetate + L-phenylalanine
show the reaction diagram
L-Phe benzyl ester + H2O = benzyl alcohol + L-phenylalanine
show the reaction diagram
Leu-Phe + H2O = Leu + Phe
show the reaction diagram
methotrexate-phenylalanine + H2O = methotrexate + phenylalanine
show the reaction diagram
show the reaction diagram
N-acetyl-L-phenylalanine + H2O = acetate + L-phenylalanine
show the reaction diagram
trans-cinnamate + NH3 = L-phenylalanine
show the reaction diagram
D-Phe = L-Phe
show the reaction diagram
ATP + H2O + phenylalanine/out = ADP + phosphate + phenylalanine/in
show the reaction diagram

Substrate in Enzyme-catalyzed Reactions (265 results)

L-phenylalanine + O2 = ? + H2O2
show the reaction diagram
L-phenylalanine + O2 = 2-oxo-3-phenylpropanoic acid + NH3
show the reaction diagram
L-phenylalanine + O2 = phenylacetamide + CO2 + H2O
show the reaction diagram
phenylalanine + NAD(P)H + O2 = tyrosine + NAD(P)+ + H2O
show the reaction diagram
L-phenylalanine + NAD+ + H2O = phenylpyruvate + NH3 + NADH + H+
show the reaction diagram
L-phenylalanine + H2O + NAD+ = phenylpyruvate + NH3 + NADH
show the reaction diagram
L-phenylalanine + H2O + NAD+ = 2-oxo-3-phenylpropanoic acid + NH3 + NADH
show the reaction diagram
L-Phe + H2O + NAD+ = phenylpyruvate + NH3 + NADH
show the reaction diagram
L-phenylalanine + O2 + H2O = phenylpyruvate + NH3 + H2O2
show the reaction diagram
L-Phe + pyruvate + NADH = N-[1-(R)-(Carboxy)ethyl]-(S)-Phe + NAD+
show the reaction diagram
acetyl-CoA + L-phenylalanine = CoA + N-acetyl-L-phenylalanine
show the reaction diagram
acetyl-CoA + L-phenylalanine = CoA + N-acetyl-L-phenylalanine
show the reaction diagram
pyruvate + L-phenylalanine = L-alanine + 2-oxo-3-phenylpropanoate
show the reaction diagram
L-phenylalanine + 2-oxoglutarate = phenylpyruvate + L-glutamate
show the reaction diagram
L-phenylalanine + 2-oxoglutarate = 3-(4-hydroxyphenyl)-2-oxopropanoate + L-glutamate
show the reaction diagram
L-phenylalanine + 2-oxoglutarate = phenylpyruvate + L-glutamate
show the reaction diagram
L-phenylalanine + 4,5-dioxopentanoate = phenylpyruvate + 5-aminolevulinate
show the reaction diagram
3-(3,4-dihydroxyphenyl)pyruvate + L-phenylalanine = 3,4-dihydroxy-L-phenylalanine + 3-phenylpyruvate
show the reaction diagram
L-phenylalanine + pyruvate = phenylpyruvate + L-alanine
show the reaction diagram
phenylalanine + glyoxylate = phenylpyruvate + glycine
show the reaction diagram
L-phenylalanine + 2-oxoglutarate = phenylpyruvate + L-glutamate
show the reaction diagram
L-phenylalanine + indole-3-pyruvic acid = phenylpyruvate + L-tryptophan
show the reaction diagram
Phe + Leu = Gly + Gly + Gly
show the reaction diagram
L-phenylalanine ethyl ester + L-phenylalanine + H2O = L-Phe-L-Phe + cyclo(L-phenylalanine-L-phenylalanine) + L-Phe-L-Phe ethyl ester
show the reaction diagram
L-phenylalanine + H2O = 2-oxo-3-phenylpropanoate + NH3
show the reaction diagram
L-phenylalanine + O2 + H2O = phenylacetaldehyde + CO2 + NH3 + H2O2
show the reaction diagram
L-phenylalanine + O2 + H2O = phenylacetaldehyde + CO2 + NH3 + H2O2
show the reaction diagram
L-Phe = 2-phenylethylamine + CO2
show the reaction diagram
L-Phe = phenylethylamine + CO2
show the reaction diagram
L-phenylalanine = phenylacetic acid + CO2
show the reaction diagram
L-phenylalanine = phenylethylamine + CO2
show the reaction diagram
L-phenylalanine = cinnamic acid + NH3
show the reaction diagram
L-phenylalanine = (E)-cinnamate + NH3
show the reaction diagram
L-phenylalanine = (E)-cinnamate + NH3
show the reaction diagram
L-Phe = (E)-cinnamate + NH3
show the reaction diagram
L-phenylalanine + pyridoxal 5'-phosphate = 2-oxo-3-phenylpropanoate + pyridoxamine 5'-phosphate
show the reaction diagram
L-phenylalanine = D-phenylalanine
show the reaction diagram
L-phenylalanine = D-phenylalanine
show the reaction diagram
L-phenylalanine = L-beta-phenylalanine
show the reaction diagram
L-phenylalanine = L-beta-phenylalanine
show the reaction diagram
ATP + L-phenylalanine + tRNAPyl = AMP + diphosphate + L-phenylalanyl-tRNAPyl
show the reaction diagram
ATP + L-arginine + phenylalanine = ? + AMP
show the reaction diagram
ATP + detyrosinated alpha-tubulin + L-Phe = ?
show the reaction diagram
ATP + (-)-jasmonate + L-Phe = AMP + diphosphate + jasmonoyl-L-Phe
show the reaction diagram
ATP + H2O + L-phenylalanine/out = ADP + phosphate + L-phenylalanine/in
show the reaction diagram
ATP + H2O + phenylalanine/out = ADP + phosphate + phenylalanine/in
show the reaction diagram

Product in Enzyme-catalyzed Reactions (442 results)

L-phenylalanine + 6-methyltetrahydropterin + O2 = L-phenylalanine + 6-methyldihydropterin + H2O2
show the reaction diagram
phenylpyruvate + NH3 + NADH = L-phenylalanine + H2O + NAD+
show the reaction diagram
phenylpyruvate + NH3 + NADPH + H+ = phenylalanine + NADP+
show the reaction diagram
beta-phenylpyruvate + NADPH + NH3 = L-phenylalanine + NADP+ + H2O
show the reaction diagram
phenylpyruvate + NH3 + NADH = L-Phe + H2O + NAD+
show the reaction diagram
5'-phospho-pyridoxyl-L-phenylalanine + H2O + O2 = pyridoxal 5'-phosphate + L-phenylalanine + H2O2
show the reaction diagram
N-methyl-L-phenylalanine + O2 + H2O = L-phenylalanine + formaldehyde + H2O2
show the reaction diagram
N-methyl L-phenylalanine + 2,6-dichlorophenolindophenol + H2O = L-phenylalanine + formaldehyde + reduced 2,6-dichlorophenolindophenol
show the reaction diagram
5-L-glutamyl-L-Phe + Gly-Gly = L-Phe + 5-L-glutamyl-Gly-Gly
show the reaction diagram
L-aspartate + phenylpyruvate = oxaloacetate + L-phenylalanine
show the reaction diagram
phenylpyruvate + 2-aminoadipate = L-phenylalanine + 2-oxoglutarate
show the reaction diagram
L-alanine + phenylpyruvate = pyruvate + L-phenylalanine
show the reaction diagram
3-(3,4-dihydroxyphenyl)-L-alanine + 3-phenylpyruvate = 3-(3,4-dihydroxyphenyl)pyruvate + L-phenylalanine
show the reaction diagram
phenylpyruvate + L-aspartate = L-phenylalanine + oxaloacetate
show the reaction diagram
phenylpyruvate + L-glutamate = L-phenylalanine + 2-oxoglutarate
show the reaction diagram
benzoylformate + L-tyrosine = L-phenylalanine + 4-hydroxyphenylpyruvate
show the reaction diagram
Phe-tRNA + H2O = Phe + tRNA
show the reaction diagram
L-Phe benzyl ester + H2O = benzyl alcohol + L-phenylalanine
show the reaction diagram
L-phenylalanine-7-amido-4-methylcoumarin + H2O = L-phenylalanine + 7-amino-4-methylcoumarin
show the reaction diagram
Lys-Phe + H2O = Lys + Phe
show the reaction diagram
L-Phe-Gly-Gly + H2O = L-Phe + Gly-Gly
show the reaction diagram
L-phenylalanyl 4-nitroanilide + H2O = L-phenylalanine + 4-nitroaniline
show the reaction diagram
L-Phe-7-amido-4-methylcoumarin + H2O = L-Phe + 7-amino-4-methylcoumarin
show the reaction diagram
L-phenylalanyl 4-nitroanilide + H2O = L-phenylalanine + 4-nitroaniline
show the reaction diagram
L-Asp-L-Phe + H2O = L-Asp + L-Phe
show the reaction diagram
Phe-Phe-Phe + H2O = Phe-Phe + Phe
show the reaction diagram
Tyr-Pro-Phe + H2O = Tyr-Pro + Phe
show the reaction diagram
N-carbobenzoxy-Ala-Ala-Phe-OH + H2O = N-carbobenzoxy-Ala-Ala + Phe
show the reaction diagram
Carbobenzoxy-Gly-Phe + H2O = Carbobenzoxy-Gly + Phe
show the reaction diagram
[3-(2-furylacryloyl)]-L-phenylalanyl-L-phenylalanine + H2O = [3-(2-furylacryloyl)]-L-phenylalanine + L-phenylalanine
show the reaction diagram
Phe-Ala + H2O = Phe + Ala
show the reaction diagram
Ac-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe + H2O = Ac-Asp-Arg-Val-Tyr-Ile-His-Pro + L-phenylalanine
show the reaction diagram
pyroglutamyl-Phe + H2O = pyroglutamate + Phe
show the reaction diagram
N-Formyl-Met-Phe + H2O = N-Formyl-Met + Phe
show the reaction diagram
hippuryl-L-phenylalanine + H2O = hippuric acid + L-phenylalanine
show the reaction diagram
benzyloxycarbonyl-Glu-Phe + H2O = benzyloxycarbonyl-Glu + Phe
show the reaction diagram
L-phenylalanine-isopropylester + H2O = L-phenylalanine + isopropanol
show the reaction diagram
N-benzyloxycarbonyl-Gly-Pro-Phe + H2O = N-benzyloxycarbonyl-Gly-Pro + L-Phe
show the reaction diagram
L-phenylalanine amide + H2O = L-phenylalanine + NH3
show the reaction diagram
L-Phe ethyl ester + H2O = L-Phe + ethanol
show the reaction diagram
Benzyloxycarbonyl-Gly-Phe + H2O = Benzyloxycarbonyl-Gly + Phe
show the reaction diagram
show the reaction diagram
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O = L-Phe + VNQH + LCGSH + L-Leu + L-Val + L-Glu + L-Ala + L-Leu + L-Tyr + LVCG + ERG + L-Phe + L-Phe + YTPKA
show the reaction diagram
Benzyloxycarbonyl-Gly-Phe + H2O = Benzyloxycarbonyl-Gly + Phe
show the reaction diagram
show the reaction diagram
show the reaction diagram
benzyloxycarbonyl-Glu-Phe + H2O = benzyloxycarbonyl-Glu + Phe
show the reaction diagram
Substance P + H2O = Arg-Pro-Lys-Pro-Gln-Gln + Phe + Phe-Gly + Leu-Met-NH2
show the reaction diagram
Drosophila tachykinin-6 + H2O = QQR + Phe + ADFNSKFVAVR-amide
show the reaction diagram
substance P fragment 2-11 + H2O = PKPQQ + Phe + Phe + GLM-NH2
show the reaction diagram
L-phenylalanine amide + H2O = L-phenylalanine + NH3
show the reaction diagram
N-phenylacetyl-Phe + H2O = phenylacetic acid + Phe
show the reaction diagram
N-acetyl-L-phenylalanine + H2O = acetate + L-phenylalanine
show the reaction diagram
jasmonoyl-L-phenylalanine + H2O = jasmonic acid + L-phenylalanine
show the reaction diagram
N-acetylphenylalanine + H2O = acetate + phenylalanine
show the reaction diagram
L-phenylalanine amide + H2O = L-Phe + NH3
show the reaction diagram
N-benzoylphenylalanine + H2O = benzoate + phenylalanine
show the reaction diagram
L-phenylalaninamide + H2O = L-phenylalanine + NH3
show the reaction diagram
N-carbamoyl-L-phenylalanine + H2O = L-phenylalanine + CO2 + NH3
show the reaction diagram
Nalpha-benzyloxycarbonyl-L-Phe + H2O = benzyl alcohol + CO2 + L-Phe
show the reaction diagram
phenyl glycinenitrile + H2O = phenylalanine + NH3
show the reaction diagram
5-L-glutamyl-L-phenylalanine = 5-oxoproline + L-phenylalanine
show the reaction diagram
D-phenylalanine = L-phenylalanine
show the reaction diagram
D-beta-phenylalanine = L-phenylalanine
show the reaction diagram
ATP + H2O + L-phenylalanine/out = ADP + phosphate + L-phenylalanine/in
show the reaction diagram
ATP + H2O + phenylalanine/out = ADP + phosphate + phenylalanine/in
show the reaction diagram

Activator in Enzyme-catalyzed Reactions (33 results)

stimulates conversion of prostaglandin G1 to H1
slightly enhanced activity
5 mM, 2.09fold activation
slightly activating, mutants S187Y, S187F, S187C
5 mM, activation of alkaline phosphatase grown in high phosphate medium to 168% of the control value
essential for the formation of a homotrimer and for the HtrA2 serine protease activity
1 mM, relative activity 140%
expression increases in response to
allosteric activator, activation above 0.1 mM
exposure of 4-week old plants to phenylalanine increases enzyme activity as well as accumulation of coumarin-related compounds
80 mM L-phenylalanine stimulates enzyme activity

Inhibitor in Enzyme-catalyzed Reactions (168 results)

long chain oxidase, 43% inhibition at 33 mM
28% inhibition at 1 mM
10 mM, 50% inhibition, competitive
0.5 mM, 21% inhibition
slight inhibition
reductive amination of pyruvate, 10 mM, 28% inhibition
20 mM, complete inhibition
; pH 7.6, 30C
10% inhibition at 250 mM, with glycine
10% inhibition at 250 mM
slight inhibition
hydroxylamine as substrate
10 mM, at pH 6.5
with 2 mM isoleucine as the substrate, 10 mM phenylalanine inhibits activity by 46%
inhibitory above 0.14 mM
2.5 mM, 10% inhibition
5 mM, 87% residual activity
33.5% activity at 1 mM
slight inhibition at 20 mM
5 mM, 10% loss of activity

Enzyme Kinetic Parameters

kcat Value (Turnover Number) (251 results)

pH 6.2, 22C
pH 7.5, 25C
pH 8, mutant enzyme A12T/P13T/N34D/T109S/G261A/S285G/A293D/N297S
pH 7.0, temperature not specified in the publication
pH 8.0, 25C
at pH 8.5 and 25C
pH 7.5, 37C, recombinant enzyme
pH 8., 35C
pH 8.0, 30C, mutant enzyme V83A

KM Value (548 results)

pH 7.5, 26C