Any feedback?
Please rate this page
(all_enzymes.php)
(0/150)

BRENDA support

3.4.23.31: Scytalidopepsin A

This is an abbreviated version!
For detailed information about Scytalidopepsin A, go to the full flat file.

Reaction

Hydrolysis of proteins with specificity similar to that of pepsin A, but also cleaves Cys(SO3H)7-/-Gly and Leu17-/-Val in the B chain of insulin =

Synonyms

Scytalidium aspartic proteinase A, Proteinase, Scytalidium lignicolum aspartic, Proteinase, Scytalidium lignicolum aspartic, A-2, Proteinase, Scytalidium lignicolum aspartic, A-I, Proteinase, Scytalidium lignicolum aspartic, C-, Scytalidium lignicolum aspartic proteinase, Scytalidium lignicolum acid proteinase, Scytalidium lignicolum carboxyl proteinase, Scytalidium sp. pepstatin-insensitive carboxyl proteinase A

ECTree

     3 Hydrolases
         3.4 Acting on peptide bonds (peptidases)
             3.4.23 Aspartic endopeptidases
                3.4.23.31 Scytalidopepsin A

Substrates Products

Substrates Products on EC 3.4.23.31 - Scytalidopepsin A

Please wait a moment until all data is loaded. This message will disappear when all data is loaded.
SUBSTRATE
PRODUCT                       
REACTION DIAGRAM
ORGANISM
UNIPROT
COMMENTARY
(Substrate) hide
LITERATURE
(Substrate)
COMMENTARY
(Product) hide
LITERATURE
(Product)
Reversibility
r=reversible
ir=irreversible
?=not specified
Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Leu-Val-Tyr-Ser + H2O
Asp-Arg-Val-Tyr + Ile-His-Pro-Phe + His-Leu + Leu-Val-Tyr-Ser
show the reaction diagram
-
cleavage of Tyr-Ile, Phe-His and Leu-Leu bond
-
-
?
Benzyloxycarbonyl-Ala-Ala-Lys-Ala-Ala-Ala + H2O
Benzyloxycarbonyl-Ala-Ala-Lys + Ala-Ala-Ala
show the reaction diagram
Benzyloxycarbonyl-Ala-Leu-Ala-Ala + H2O
Benzyloxycarbonyl-Ala-Leu + Ala-Ala
show the reaction diagram
Benzyloxycarbonyl-Ala-Lys-Ala-Ala-Ala + H2O
Benzyloxycarbonyl-Ala-Lys + Ala-Ala-Ala
show the reaction diagram
benzyloxycarbonyl-Ala-Phe-Gly-Ala + H2O
benzyloxycarbonyl-Ala-Phe + Gly-Ala
show the reaction diagram
-
-
-
-
?
benzyloxycarbonyl-Ala-Phe-Leu-Ala + H2O
benzyloxycarbonyl-Ala-Phe + Leu-Ala
show the reaction diagram
-
-
-
-
?
Benzyloxycarbonyl-Gly-Leu-Ala-Ala + H2O
Benzyloxycarbonyl-Gly-Leu + Ala-Ala
show the reaction diagram
benzyloxycarbonyl-Gly-Phe-Leu-Ala + H2O
benzyloxycarbonyl-Gly-Phe + Leu-Ala
show the reaction diagram
-
-
-
-
?
Benzyloxycarbonyl-Leu-Ala-Ala + H2O
Benzyloxycarbonyl-Leu + Ala-Ala
show the reaction diagram
-
slow hydrolysis
-
?
benzyloxycarbonyl-Lys-Ala-Ala-Ala + H2O
benzyloxycarbonyl-Lys-Ala + Ala-Ala
show the reaction diagram
-
-
-
-
?
benzyloxycarbonyl-Lys-Leu-Ala-Ala + H2O
benzyloxycarbonyl-Lys-Leu + Ala-Ala
show the reaction diagram
-
-
-
-
?
benzyloxycarbonyl-Phe-Glu-Ala-Ala + H2O
benzyloxycarbonyl-Phe-Glu + Ala-Ala
show the reaction diagram
-
-
-
-
?
Benzyloxycarbonyl-Phe-Leu-Ala + H2O
Benzyloxycarbonyl-Phe + Leu-Ala
show the reaction diagram
Benzyloxycarbonyl-Phe-Leu-Ala-Ala + H2O
?
show the reaction diagram
Benzyloxycarbonyl-Phe-Leu-Ala-Ala + H2O
Benzyloxycarbonyl-Phe-Leu + Ala-Ala
show the reaction diagram
benzyloxycarbonyl-Phe-Lys-Ala-Ala + H2O
benzyloxycarbonyl-Phe-Lys + Ala-Ala
show the reaction diagram
-
-
-
-
?
Benzyloxycarbonyl-Phe-Tyr-Ala + H2O
Benzyloxycarbonyl-Phe + Tyr-Ala
show the reaction diagram
Benzyloxycarbonyl-Phe-Tyr-Ala-Ala + H2O
Benzyloxycarbonyl-Phe-Tyr + Ala-Ala
show the reaction diagram
casein + H2O
?
show the reaction diagram
FVNQHLCGSHLVEALYLVCGERGFFYTPKA + H2O
FVNQHLC + GSHLVEALYLVCGERGF + FYTPKA
show the reaction diagram
-
i.e. insulin B chain, cleavage site specificity
-
-
?
N-tert-Butoxycarbonyl-Phe-Arg(NO2)-Ala-Phe 4-nitrophenyl ester + H2O
?
show the reaction diagram
N-tert-Butoxycarbonyl-Phe-Arg(NO2)-Gly-Phe 4-nitrophenyl ester + H2O
?
show the reaction diagram
Oxidized insulin B-chain + H2O
?
show the reaction diagram
-
specifically hydrolyzes Cys7-Gly8 bond
-
-
?
Phenyloxycarbonyl-Ala-Ala-Lys-Ala-Ala-Ala + H2O
Phenyloxycarbonyl-Ala-Ala-Lys + Ala-Ala-Ala
show the reaction diagram
-
-
-
?
Phenyloxycarbonyl-Ala-Lys-Ala-Ala-Ala + H2O
Phenyloxycarbonyl-Ala-Lys + Ala-Ala-Ala
show the reaction diagram
-
-
-
?
Phenyloxycarbonyl-Ala-Phe-Gly-Ala + H2O
Phenyloxycarbonyl-Ala-Phe + Gly-Ala
show the reaction diagram
-
-
-
-
?
Phenyloxycarbonyl-Ala-Phe-Leu-Ala + H2O
Phenyloxycarbonyl-Ala-Phe + Leu-Ala
show the reaction diagram
-
-
-
?
Phenyloxycarbonyl-Glu-Leu-Ala-Ala + H2O
Phenyloxycarbonyl-Glu-Leu + Ala-Ala
show the reaction diagram
-
-
-
?
Phenyloxycarbonyl-Gly-Leu-Gly-Phe + H2O
Phenyloxycarbonyl-Gly-Leu + Gly-Phe
show the reaction diagram
-
-
-
?
Phenyloxycarbonyl-Gly-Phe-Gly-Ala + H2O
Phenyloxycarbonyl-Gly-Phe + Gly-Ala
show the reaction diagram
-
-
-
?
Phenyloxycarbonyl-Leu-Leu-Ala-Ala + H2O
Phenyloxycarbonyl-Leu-Leu + Ala-Ala
show the reaction diagram
-
-
-
?
Phenyloxycarbonyl-Lys-Ala-Ala-Ala-Ala + H2O
Phenyloxycarbonyl-Lys-Ala + Ala-Ala-Ala
show the reaction diagram
-
-
-
?
Phenyloxycarbonyl-Lys-Leu-Ala-Ala + H2O
Phenyloxycarbonyl-Lys-Leu + Ala-Ala
show the reaction diagram
-
-
-
?
Phenyloxycarbonyl-Phe-Ala-Ala-Ala + H2O
Phenyloxycarbonyl-Phe-Ala + Ala-Ala
show the reaction diagram
-
-
-
?
Phenyloxycarbonyl-Phe-Glu-Ala-Ala + H2O
Phenyloxycarbonyl-Phe-Glu + Ala-Ala
show the reaction diagram
-
-
-
?
Phenyloxycarbonyl-Phe-Gly-Ala + H2O
?
show the reaction diagram
-
-
-
-
?
Phenyloxycarbonyl-Phe-Leu-Ala-Ala + H2O
Phenyloxycarbonyl-Phe-Leu + Ala-Ala
show the reaction diagram
-
-
-
?
Phenyloxycarbonyl-Phe-Lys-Ala-Ala + H2O
Phenyloxycarbonyl-Phe-Lys + Ala-Ala
show the reaction diagram
-
-
-
?
Phenyloxycarbonyl-Tyr-Leu-Ala-Ala + H2O
Phenyloxycarbonyl-Tyr-Leu + Ala-Ala
show the reaction diagram
-
-
-
?
Proangiotensin + H2O
?
show the reaction diagram
-
enzyme form A-1 hydrolyzes Tyr4-Ile5 and Phe8-His9
-
-
?
Succinyl-Phe-Arg-Ala-Phe 4-nitrophenyl ester + H2O
?
show the reaction diagram
Z-Phe-Xaa-Ala-Ala + H2O
Z-Phe-Xaa + Ala-Ala
show the reaction diagram
-
cleavage site specificity
-
-
?
Z-Xaa-Leu-Ala-Ala + H2O
Z-Xaa-Leu + Ala-Ala
show the reaction diagram
-
cleavage site specificity
-
-
?
additional information
?
-